PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G49760.1
Common NameAtbZIP5, bZIP5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 156aa    MW: 18360.1 Da    PI: 9.987
Description basic leucine-zipper 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G49760.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.54.3e-1172130563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +rk +NRe+A+rsR++K++ +ee      +L+ +N++Lk++l     ++++ k+e+
  AT3G49760.1  72 RKKKRKLSNRESAKRSREKKQKHLEEMSIQLNQLKIQNQELKNQLRYVLYHCQRTKMEN 130
                  6899****************************************999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-1063125No hitNo description
SMARTSM003381.9E-1268132IPR004827Basic-leucine zipper domain
PfamPF077161.8E-869116IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64570133IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.94E-972120No hitNo description
CDDcd147025.20E-1773124No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0003015anatomyprimary root differentiation zone
PO:0006203anatomypericycle
PO:0009005anatomyroot
PO:0020124anatomyroot stele
PO:0025257anatomyprimary root elongation zone
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MMSTISPVFS TEPGLLTSVL PAFETSFTPW DISHLFSVFD SLIDPKPVST HDYGSVNQIG  60
SDMSPTDNTD ERKKKRKLSN RESAKRSREK KQKHLEEMSI QLNQLKIQNQ ELKNQLRYVL  120
YHCQRTKMEN DRLLMEHRIL HDKLLNIRQV LMFRQT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17077ERKKKRKL
27192RKKKRKLSNRESAKRSREKKQK
37277KKKRKL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1107421320.0
Genevisible252232_at0.0
Expression AtlasAT3G49760-
AtGenExpressAT3G49760-
ATTED-IIAT3G49760-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G49760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G49760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269230.0AK226923.1 Arabidopsis thaliana mRNA for bZIP transcription factor AtbZip5, complete cds, clone: RAFL09-21-L10.
GenBankAL1329650.0AL132965.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T16K5.
GenBankBT0248230.0BT024823.1 Arabidopsis thaliana At3g49760 gene, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566925.11e-113basic leucine-zipper 5
TrEMBLQ29PT31e-113Q29PT3_ARATH; At3g49760
STRINGAT3G49760.11e-113(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Representative plantOGRP8744815
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  6. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  7. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  8. Diet A, et al.
    The Arabidopsis root hair cell wall formation mutant lrx1 is suppressed by mutations in the RHM1 gene encoding a UDP-L-rhamnose synthase.
    Plant Cell, 2006. 18(7): p. 1630-41
    [PMID:16766693]
  9. Dinneny JR, et al.
    Cell identity mediates the response of Arabidopsis roots to abiotic stress.
    Science, 2008. 320(5878): p. 942-5
    [PMID:18436742]